View bacteriocin : Divergicin 750 Bookmark and Share

Accession BAC051
Name Divergicin 750
Related Entries Divergicin M35Divergicin A
Gene dvn750
Class Unclassified
Producer Organism Carnobacterium divergens [Gram-positive]
Taxonomy BacteriaFirmicutesLactobacillalesCarnobacteriaceaeCarnobacterium
Target organisms Carnobacterium - Enterococcus - Listeria monocytogenes - Clostridium perfringens
Swiss-Prot Entry Q46597
PDB Entry Unknown
Other databases EMBL Z54201InterPro IPR010133TIGRFAMs TIGR01847
[Ref. 1] | View abstract | Export citation
NUCLEOTIDE SEQUENCE, STRAIN=750
MEDLINE=97023140;PubMed=8869500;DOI=10.1016/0378-1097(95)00500-5
Holck A.L., Axelsson L.T., Schillinger U.
"Divergicin 750, a novel bacteriocin produced by Carnobacterium divergens 750.", FEMS Microbiol. Lett. 136:163-168(1996).

Loading...
End Note
Reference Manager
BibTeX
Sequence
........10........20........30........40
| | | |
KGILGKLGVVQAGVDFVSGVWAGIKQSAKDHPNA
Wheel representation
Composition
AA N° %

AA N° %

AA N° %
Ala 4 11.76%

Ile 2 5.88%

Arg 0 .00%
Cys 0 .00%

Lys 4 11.76%

Ser 2 5.88%
Asp 2 5.88%

Leu 2 5.88%

Thr 0 .00%
Glu 0 .00%

Met 0 .00%

Val 5 14.71%
Phe 1 2.94%

Asn 1 2.94%

Trp 1 2.94%
Gly 6 17.65%

Pro 1 2.94%

Tyr 0 .00%
His 1 2.94%

Gln 2 5.88%
Total 34
Formula C156 H252 N44 O44
Absent amino acids CEMRTY
Common amino acids G
Mass (Da) 3466.58
Net charge +3
Isoelectric point 10.33
Basic residues 5
Acidic residues 2
Hydrophobic residues 15
Polar residues 9
Aliphatic residues 9
Tiny residues 12
Boman Index -10.75
Hydropathy Index 0.14
Aliphatic Index 100.29
Instability Index 8.37 (stable)
Half Life Mammalian : 1.3 hour
Yeast : 3 min
E. coli : 2 min
Extinction Coefficient 5500 M-1 cm-1
Absorbance 280nm 166.67
Red solid plot : values according to the hydrophobicity scale of Kyte and Doolittle (reference paper).


Yellow dashed plot : Experimentally determined hydrophobicity scale for proteins at membrane interfaces(reference paper).


Green dotted-dashed plot : prediction of transmembrane helices (reference paper). In this scale (unlike the others), more negative values reflect greater hydrophobicity.

Users comments for Divergicin 750

No comments found

Login or register to submit a comment for Divergicin 750.