View bacteriocin : Enterocin I (Enterocin L50A) Bookmark and Share

[Ref. 1] | View abstract | Export citation
NUCLEOTIDE SEQUENCE, STRAIN=6T1a
MEDLINE=99054929;PubMed=9835578;
Floriano B., Ruiz-Barba J.L., Jimenez-Diaz R.
"Purification and genetic characterization of enterocin I from Enterococcus faecium 6T1a, a novel antilisterial plasmid-encoded bacteriocin which does not belong to the pediocin family of bacteriocins.", Appl. Environ. Microbiol. 64:4883-4890(1998).

[Ref. 2] | View abstract | Export citation
NUCLEOTIDE SEQUENCE, STRAIN=L50
MEDLINE=98215162;PubMed=9555877;
Cintas L.M., Casaus P., Holo H., Hernandez P.E., Nes I.F., Havarstein L.S.
"Enterocins L50A and L50B, two novel bacteriocins from Enterococcus faecium L50, are related to staphylococcal hemolysins.", J. Bacteriol. 180:1988-1994(1998).

Loading...
End Note
Reference Manager
BibTeX
Sequence
........10........20........30........40........50
| | | | |
MGAIAKLVAKFGWPIVKKYYKQIMQFIGEGWAINKIIEWIKKHI

Wheel representation
Composition
AA %

AA %

AA %
Ala 4 9.09%

Ile 9 20.45%

Arg 0 .00%
Cys 0 .00%

Lys 8 18.18%

Ser 0 .00%
Asp 0 .00%

Leu 1 2.27%

Thr 0 .00%
Glu 2 4.55%

Met 2 4.55%

Val 2 4.55%
Phe 2 4.55%

Asn 1 2.27%

Trp 3 6.82%
Gly 4 9.09%

Pro 1 2.27%

Tyr 2 4.55%
His 1 2.27%

Gln 2 4.55%
Total 44
Formula C252 H392 N60 O54 S2
Absent amino acids CDRST
Common amino acids I
Mass (Da) 5209.14
Net charge +7
Isoelectric point 10.68
Basic residues 9
Acidic residues 2
Hydrophobic residues 21
Polar residues 7
Aliphatic residues 12
Tiny residues 8
Boman Index 5.25
Hydropathy Index 0.2
Aliphatic Index 110.91
Instability Index 26.65 (stable)
Half Life Mammalian : 30 hour
Yeast : >20 hour
E. coli : >10 hour
Extinction Coefficient 19480 M-1 cm-1
Absorbance 280nm 453.02
Red solid plot : values according to the hydrophobicity scale of Kyte and Doolittle (reference paper).


Yellow dashed plot : Experimentally determined hydrophobicity scale for proteins at membrane interfaces(reference paper).


Green dotted-dashed plot : prediction of transmembrane helices (reference paper). In this scale (unlike the others), more negative values reflect greater hydrophobicity.

Users comments for Enterocin I (Enterocin L50A)

No comments found

Login or register to submit a comment for Enterocin I (Enterocin L50A).