View bacteriocin : Enterocin AS-48 (BACTERIOCIN AS-48) Bookmark and Share

Accession BAC143
Name Enterocin AS-48 (BACTERIOCIN AS-48)
Related Entries Enterocin QEnterocin PEnterocin I (Enterocin L50A)Enterocin AEnterocin B

Enterocin 1071AEnterocin CRL35Enterocin SE-K4Enterocin 96Enterocin E-760

Enterocin-HF
Gene as-48
Class Unclassified
Producer Organism Enterococcus faecalis (Streptococcus faecalis) [Gram-positive]
Taxonomy BacteriaFirmicutesLactobacillalesEnterococcaceaeEnterococcus.
Target organisms Gram-positive species: - Bacillus subtilus - Bacillus cereus - Bacillus circulans - Bacillus megaterium - Corynebacterium glutamicum - Corybacterium bovis - Mycobacterium phlei - Nocardia corrallina - Micrococcus luteus - Micrococcus lysodeikticus - Staphylococcus aureus - Streptococcus faecalis - Streptococcus faecium -

Gram-negative species: - Enterobacter cloacae - Escherichia coli - Klebsiella pneumoniae - Proteus inconstans - Salmonella typhimurium - Shigella sonnei - Pseudomonas fluorescens - Pseudomonas aeruginosa - Pseudomonas reptilivora -

note: not active against Alcaligenes faecalis - Proteus sp - Pasteurella sp
Swiss-Prot Entry Q47765
PDB Entry 1E68 resolved by NMR 1O82 resolved by X-ray 1O83 resolved by X-ray 1O84 resolved by X-ray
Other databases EMBL X79542EMBL Y12234PIR S47168InterPro IPR009086Gene3D G3DSA:1.20.225.10

Pfam PF09221
Description The antimicrobial effect of AS-48 is due to its ability to form pores in the membranes of sensitive bacteria, leading to the efflux of small molecules and the depletion of the membrane electrical potential and ultimately leading to cell death
[Ref. 1] | View abstract | Export citation
NUCLEOTIDE SEQUENCE, STRAIN=S-48; PLASMID=BglII;
MEDLINE=95014079;PubMed=7929005;
Martinez-Bueno M., Maqueda M., Galvez A., Samyn B., Van Beeumen J., Coyette J., Valdivia E.
"Determination of the gene sequence and the molecular structure of the enterococcal peptide antibiotic AS-48.", J. Bacteriol. 176:6334-6339(1994).

[Ref. 2] | View abstract | Export citation
PROTEIN SEQUENCE, PLASMID=BglII;
MEDLINE=95010683;PubMed=7925951;DOI=10.1016/0014-5793(94)00925-2
Samyn B., Martinez-Bueno M., Devreese B., Maqueda M., Galvez A., Valdivia E., Coyette J., Van Beeumen J.
"The cyclic structure of the enterococcal peptide antibiotic AS-48.", FEBS Lett. 352:87-90(1994).

[Ref. 3]
PROTEIN STRUCTURE

Gonzalez, C., Langdon, G.M., Bruix, M., Galvez, A., Valdivia, E., Maqueda, M., Rico, M.
"Bacteriocin AS-48, a microbial cyclic polypeptide structurally and functionally related to mammalian NK-lysin.", Proc.Natl.Acad.Sci.USA (2000) 97: 11221-11226.

[Ref. 4] | View abstract | Export citation
Characterization of AS-48
PubMed=3098396;
Gálvez A., Maqueda M., Valdivia E., Quesada A., Montoya E.
"Characterization and partial purification of a broad spectrum antibiotic AS-48 produced by Streptococcus faecalis.", Can. j. Microbiol. 32(10):765-771(1986)

Loading...
End Note
Reference Manager
BibTeX
Sequence
........10........20........30........40........50........60........70........80
| | | | | | | |
MAKEFGIPAAVAGTVLNVVEAGGWVTTIVSILTAVGSGGLSLLAAAGRESIKAYLKKEIKKKGKRAVIAW

Wheel representation
Structure
Composition
AA %

AA %

AA %
Ala 12 17.14%

Ile 6 8.57%

Arg 2 2.86%
Cys 0 .00%

Lys 8 11.43%

Ser 4 5.71%
Asp 0 .00%

Leu 6 8.57%

Thr 4 5.71%
Glu 4 5.71%

Met 1 1.43%

Val 8 11.43%
Phe 1 1.43%

Asn 1 1.43%

Trp 2 2.86%
Gly 9 12.86%

Pro 1 1.43%

Tyr 1 1.43%
His 0 .00%

Gln 0 .00%
Total 70
Formula C328 H549 N87 O89 S1
Absent amino acids CDHQ
Common amino acids A
Mass (Da) 7186.77
Net charge +6
Isoelectric point 10.83
Basic residues 10
Acidic residues 4
Hydrophobic residues 35
Polar residues 19
Aliphatic residues 20
Tiny residues 25
Boman Index -0.61
Hydropathy Index 0.54
Aliphatic Index 117.14
Instability Index 18.82 (stable)
Half Life Mammalian : 30 hour
Yeast : >20 hour
E. coli : >10 hour
Extinction Coefficient 12490 M-1 cm-1
Absorbance 280nm 181.01
Red solid plot : values according to the hydrophobicity scale of Kyte and Doolittle (reference paper).


Yellow dashed plot : Experimentally determined hydrophobicity scale for proteins at membrane interfaces(reference paper).


Green dotted-dashed plot : prediction of transmembrane helices (reference paper). In this scale (unlike the others), more negative values reflect greater hydrophobicity.

Users comments for Enterocin AS-48 (BACTERIOCIN AS-48)

No comments found

Login or register to submit a comment for Enterocin AS-48 (BACTERIOCIN AS-48).