View bacteriocin : Reutericin 6 Bookmark and Share

Accession BAC168
Name Reutericin 6
Gene gaaA
Class class II
Producer Organism Lactobacillus reuteri LA6 [Gram-positive]
Taxonomy BacteriaFirmicutesLactobacillalesLactobacillaceaeLactobacillus
Target organisms Lactobacillus delbrueckii subsp. bulgaricus JCM1002
Swiss-Prot Entry No entry found
PDB Entry Unknown
Description STRUCTURE:
Reutericin 6, a bacteriocin produced by Lactobacillus reuteri LA6 that was isolated from the faeces of a human infant at 2 months of age, was purified to homogeneity from broth culture-supernatant by reverse-phase chromatography. Molecular weight (5652) by mass spectrometry and primary structure of reutericin 6 were identical to that of gassericin A produced by Lactobacillus gasseri LA39 which was isolated from the faeces of the same human infant at 4 months old. Reutericin 6 was shown to be a class II and cyclic bacteriocin. PCR amplification on the chromosome DNA of L. reuteri LA6 as a template with the primers based on the DNA sequences cloned (gassericin A and acidocin B from Lactobacillus acidophilus M46) and sequencing revealed that L. reuteri LA6 has the structural gene for gassericin A with no variations among those primers. These results indicate that a bacteriocin of the same structure has been produced by different lactobacilli species isolated from the same infant.

ACTIVITY:
gassericin A inhibited the growth of L. reuteri LA6, but reutericin 6, which has a narrower spectrum than gassericin A, did not inhibit the growth of Lactobacillus gasseri LA39.
[Ref. 1]
NUCLEOTIDE SEQUENCE
DOI=10.1006/fmic.2001.0412
Kawai, Y., Y. Ishii, K. Uemura, H. Kitazawa, T. Saito, and T. Itoh.
"Lactobacillus reuteri LA6 and Lactobacillus gasseri LA39 isolated from feces of the same human infant produce identical cyclic bacteriocin.", Food Microbiol. 18:407-415 (2001).

Loading...
End Note
Reference Manager
BibTeX
Sequence
........10........20........30........40........50........60
| | | | | |
IYWIADQFGIHLATGTARKLLDAMASGASLGTAFAAILGVTLPAWALAAAGALGATAA
Wheel representation
Composition
AA N° %

AA N° %

AA N° %
Ala 18 31.03%

Ile 4 6.90%

Arg 1 1.72%
Cys 0 .00%

Lys 1 1.72%

Ser 2 3.45%
Asp 2 3.45%

Leu 8 13.79%

Thr 5 8.62%
Glu 0 .00%

Met 1 1.72%

Val 1 1.72%
Phe 2 3.45%

Asn 0 .00%

Trp 2 3.45%
Gly 7 12.07%

Pro 1 1.72%

Tyr 1 1.72%
His 1 1.72%

Gln 1 1.72%
Total 58
Formula C261 H411 N67 O72 S1
Absent amino acids CEN
Common amino acids A
Mass (Da) 5672.18
Net charge +1
Isoelectric point 7.54
Basic residues 3
Acidic residues 2
Hydrophobic residues 35
Polar residues 15
Aliphatic residues 13
Tiny residues 27
Boman Index 47.31
Hydropathy Index 0.997
Aliphatic Index 31.62
Instability Index 3.73 (stable)
Half Life Mammalian : 20 hour
Yeast : 30 min
E. coli : >10 hour
Extinction Coefficient 19490 M-1 cm-1
Absorbance 280nm 219.12
Red solid plot : values according to the hydrophobicity scale of Kyte and Doolittle (reference paper).


Yellow dashed plot : Experimentally determined hydrophobicity scale for proteins at membrane interfaces(reference paper).


Green dotted-dashed plot : prediction of transmembrane helices (reference paper). In this scale (unlike the others), more negative values reflect greater hydrophobicity.

Users comments for Reutericin 6

No comments found

Login or register to submit a comment for Reutericin 6.