View bacteriocin : Enterocin E-760 Bookmark and Share

Accession BAC174
Name Enterocin E-760
Related Entries Enterocin QEnterocin PEnterocin I (Enterocin L50A)Enterocin AEnterocin B

Enterocin 1071AEnterocin CRL35Enterocin SE-K4Enterocin AS-48 (BACTERIOCIN AS-48)Enterocin 96

Enterocin-HF
Gene Unidentified
Class class IIb
Producer Organism Enterococcus sp [Gram-positive]
Taxonomy BacteriaFirmicutesLactobacillalesEnterococcaceaeEnterococcus
Target organisms Gram-positive bacteria: Staphylococcus aureus - Staphylococcus epidermidis - Listeria monocytogenes 9-72 -

Gram-negative bacteria: Campylobacter sp - Salmonella enterica serovar Enteritidis 1 - Salmonella enterica serovar Enteritidis 4 - Salmonella enterica serovar Enteritidis 204 - Salmonella enterica serovar Enteritidis 237 - Salmonella enterica serovar Choleraesuis 434/4 - Salmonella enterica serovar Choleraesuis 370 - Salmonella enterica serovar Typhimurium 383/60 - Salmonella enterica serovar Typhimurium 320 - Salmonella enterica serovar Gallinarum biovar Pullorum - Escherichia coli HB101 - Escherichia coli C600 - Escherichia coli O157:H7 Y-63 - Escherichia coli O157:H7 G-3 - Escherichia coli O157:H7 OD-3 - Escherichia coli O157:H7 T-39 - Yersinia enterocolitica 03 - Yersinia enterocolitica 09 - Yersinia enterocolitica 04 - Yersinia pseudotuberculosis ser 4 - Yersinia pseudotuberculosis 14 - Citrobacter freundii - Klebsiella pneumoniae - Shigella dysenteriae - Campylobacter jejuni L4
Swiss-Prot Entry P85147
PDB Entry Unknown
Other databases GO GO:0005576GO GO:0005102GO GO:0019835GO GO:0042742
[Ref. 1] | View abstract | Export citation
[1]PROTEIN SEQUENCE, FUNCTION,IOPHYSICOCHEMICAL PROPERTIES, SUBCELLULARLOCATION, AND MASS SPECTROMETRY.STRAIN=NRRL B-30745
PubMed=18086839;DOI=10.1128/AAC.01569-06
Line J.E., Svetoch E.A., Eruslanov B.V., Perelygin V.V., Mitsevich E.V., Mitsevich I.P., Levchuk V.P., Svetoch O.E., Seal B., Siragusa G., Stern N.J.
"Isolation and purification of enterocin E-760 with broadantimicrobial activity against Gram-positive and Gram-negativebacteria.", Antimicrob. Agents Chemother. 52:1094-1100(2008)

Loading...
End Note
Reference Manager
BibTeX
Sequence
........10........20........30........40........50........60........70
| | | | | | |
NRWYCNSAAGGVGGAAVCGLAGYVGEAKENIAGEVRKGWGMAGGFTHNKACKSFPGSGWASG
Wheel representation
Composition
AA N° %

AA N° %

AA N° %
Ala 10 16.13%

Ile 1 1.61%

Arg 2 3.23%
Cys 3 4.84%

Lys 4 6.45%

Ser 4 6.45%
Asp 0 .00%

Leu 1 1.61%

Thr 1 1.61%
Glu 3 4.84%

Met 1 1.61%

Val 4 6.45%
Phe 2 3.23%

Asn 4 6.45%

Trp 3 4.84%
Gly 15 24.19%

Pro 1 1.61%

Tyr 2 3.23%
His 1 1.61%

Gln 0 .00%
Total 62
Formula C269 H403 N81 O80 S4
Absent amino acids DQ
Common amino acids G
Mass (Da) 6198.95
Net charge +4
Isoelectric point 8.91
Basic residues 7
Acidic residues 3
Hydrophobic residues 21
Polar residues 29
Aliphatic residues 6
Tiny residues 29
Boman Index -42.8
Hydropathy Index -0.18
Aliphatic Index 47.42
Instability Index 42.56 (unstable)
Half Life Mammalian : 1.4 hour
Yeast : 3 min
E. coli : >10 hour
Extinction Coefficient 19480 M-1 cm-1
Absorbance 280nm 321.39
Red solid plot : values according to the hydrophobicity scale of Kyte and Doolittle (reference paper).


Yellow dashed plot : Experimentally determined hydrophobicity scale for proteins at membrane interfaces(reference paper).


Green dotted-dashed plot : prediction of transmembrane helices (reference paper). In this scale (unlike the others), more negative values reflect greater hydrophobicity.

Users comments for Enterocin E-760

No comments found

Login or register to submit a comment for Enterocin E-760.